Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [419326] (31 PDB entries) Uniprot P38501 |
Domain d2pp9c1: 2pp9 C:4-166 [149745] Other proteins in same PDB: d2pp9a2, d2pp9b2, d2pp9c2 automated match to d1snra1 complexed with act, cu, cu1, no3, trs |
PDB Entry: 2pp9 (more details), 1.8 Å
SCOPe Domain Sequences for d2pp9c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pp9c1 b.6.1.3 (C:4-166) Nitrite reductase, NIR, N-terminal domain {Alcaligenes faecalis, strain s-6 [TaxId: 511]} ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk
Timeline for d2pp9c1:
View in 3D Domains from other chains: (mouse over for more information) d2pp9a1, d2pp9a2, d2pp9b1, d2pp9b2 |