SCOPe 2.07: Domain d2pp9a2: 2pp9 A:167-339

Lineage for d2pp9a2 (2pp9 A:167-339)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (31 PDB entries)
   Uniprot P38501

8. Domain d2pp9a2: 2pp9 A:167-339 [149742]
   automated match to d1snra2
   complexed with act, cu, cu1, no3, trs

Details for d2pp9a2

PDB Entry: 2pp9, 1.8 Å

PDB Description: Nitrate bound wild type oxidized AfNiR

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2pp9a2:

Sequence; same for both SEQRES and ATOM records:

>d2pp9a2 b.6.1.3 (A:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg

Timeline for d2pp9a2:

• d2pp9a2 first appeared in SCOP 1.75
  
• d2pp9a2 appears in SCOPe 2.06
  
• d2pp9a2 appears in the current release, SCOPe 2.08