Class b: All beta proteins [48724] (176 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Nitrite reductase, NIR [49551] (5 species) consists of two domains of this fold |
Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (31 PDB entries) Uniprot P38501 |
Domain d2pp9a2: 2pp9 A:167-339 [149742] automated match to d1snra2 complexed with act, cu, cu1, no3, trs |
PDB Entry: 2pp9 (more details), 1.8 Å
SCOPe Domain Sequences for d2pp9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pp9a2 b.6.1.3 (A:167-339) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]} gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsg
Timeline for d2pp9a2:
View in 3D Domains from other chains: (mouse over for more information) d2pp9b1, d2pp9b2, d2pp9c1, d2pp9c2 |