Lineage for d2pp8c2 (2pp8 C:167-337)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791546Family b.6.1.3: Multidomain cupredoxins [49550] (7 protein domains)
  6. 791669Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 791707Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (33 PDB entries)
    Uniprot P38501
  8. 791731Domain d2pp8c2: 2pp8 C:167-337 [149740]
    automatically matched to d1ndra2
    complexed with act, cu, cu1, fmt, trs

Details for d2pp8c2

PDB Entry: 2pp8 (more details), 1.5 Å

PDB Description: Formate bound to oxidized wild type AfNiR
PDB Compounds: (C:) Copper-containing nitrite reductase

SCOP Domain Sequences for d2pp8c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pp8c2 b.6.1.3 (C:167-337) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlap

SCOP Domain Coordinates for d2pp8c2:

Click to download the PDB-style file with coordinates for d2pp8c2.
(The format of our PDB-style files is described here.)

Timeline for d2pp8c2: