Lineage for d2pp8b1 (2pp8 B:4-166)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381028Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 2381275Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 2381404Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49553] (31 PDB entries)
    Uniprot P38501
  8. 2381419Domain d2pp8b1: 2pp8 B:4-166 [149737]
    automated match to d1snra1
    complexed with act, cu, cu1, fmt, trs

Details for d2pp8b1

PDB Entry: 2pp8 (more details), 1.5 Å

PDB Description: Formate bound to oxidized wild type AfNiR
PDB Compounds: (B:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2pp8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pp8b1 b.6.1.3 (B:4-166) Nitrite reductase, NIR {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgk

SCOPe Domain Coordinates for d2pp8b1:

Click to download the PDB-style file with coordinates for d2pp8b1.
(The format of our PDB-style files is described here.)

Timeline for d2pp8b1: