Lineage for d2pp6a1 (2pp6 A:1-93)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820941Fold b.106: Phage tail proteins [69278] (1 superfamily)
    core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel
  4. 2820942Superfamily b.106.1: Phage tail proteins [69279] (4 families) (S)
  5. 2820982Family b.106.1.2: gpFII-like [74966] (2 proteins)
    similar to the N-terminal barrel of T4 gp27
    automatically mapped to Pfam PF13856
  6. 2820983Protein Gifsy-2 prophage protein STM1035 [159183] (1 species)
    ATP-binding sugar transporter-like protein
  7. 2820984Species Salmonella typhimurium [TaxId:90371] [159184] (1 PDB entry)
    Uniprot Q8ZQ92 1-93
  8. 2820985Domain d2pp6a1: 2pp6 A:1-93 [149728]
    Other proteins in same PDB: d2pp6a2

Details for d2pp6a1

PDB Entry: 2pp6 (more details), 2.7 Å

PDB Description: crystal structure of the atp-binding sugar transporter-like protein from salmonella typhimurium
PDB Compounds: (A:) Gifsy-2 prophage ATP-binding sugar transporter-like protein

SCOPe Domain Sequences for d2pp6a1:

Sequence, based on SEQRES records: (download)

>d2pp6a1 b.106.1.2 (A:1-93) Gifsy-2 prophage protein STM1035 {Salmonella typhimurium [TaxId: 90371]}
madlfdgmkrrmdaliaerfgmkvningtdcivvesdflaelgpvegngknvvvfsgnvi
prrgdrvvlrgseftvtrirrfngkpqltleen

Sequence, based on observed residues (ATOM records): (download)

>d2pp6a1 b.106.1.2 (A:1-93) Gifsy-2 prophage protein STM1035 {Salmonella typhimurium [TaxId: 90371]}
madlfdgmkrrmdaliaerfgmkvningtdcivvesdflagknvvvfsgnviprrgdrvv
lrgseftvtrirrfngkpqltleen

SCOPe Domain Coordinates for d2pp6a1:

Click to download the PDB-style file with coordinates for d2pp6a1.
(The format of our PDB-style files is described here.)

Timeline for d2pp6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pp6a2