Lineage for d2pp4a1 (2pp4 A:119-225)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738960Fold a.277: TAFH domain-like [158552] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2738961Superfamily a.277.1: TAFH domain-like [158553] (1 family) (S)
    automatically mapped to Pfam PF07531
  5. 2738962Family a.277.1.1: TAFH domain-like [158554] (2 proteins)
    Pfam PF07531
  6. 2738963Protein ETO [158557] (1 species)
    Synonyms: AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2
  7. 2738964Species Human (Homo sapiens) [TaxId:9606] [158558] (3 PDB entries)
    Uniprot Q06455 119-225! Uniprot Q06455 120-222
  8. 2738965Domain d2pp4a1: 2pp4 A:119-225 [149727]

Details for d2pp4a1

PDB Entry: 2pp4 (more details)

PDB Description: solution structure of eto-tafh refined in explicit solvent
PDB Compounds: (A:) Protein ETO

SCOPe Domain Sequences for d2pp4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pp4a1 a.277.1.1 (A:119-225) ETO {Human (Homo sapiens) [TaxId: 9606]}
garqlsklkrflttlqqygndispeigervrtlvlglvnstltieefhsklqeatnfplr
pfvipflkanlpllqrellhcarlakqnpaqylaqheqllldastts

SCOPe Domain Coordinates for d2pp4a1:

Click to download the PDB-style file with coordinates for d2pp4a1.
(The format of our PDB-style files is described here.)

Timeline for d2pp4a1: