SCOPe 2.05: Domain d2ponb_: 2pon B:

Lineage for d2ponb_ (2pon B:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (32 PDB entries)

8. Domain d2ponb_: 2pon B: [149723]
   automated match to d3sp7a_

Details for d2ponb_

PDB Entry: 2pon

PDB Description: solution structure of the bcl-xl/beclin-1 complex

PDB Compounds: (B:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d2ponb_:

Sequence; same for both SEQRES and ATOM records:

>d2ponb_ f.1.4.1 (B:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelr
yrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
vlvsriaawmatylndhlepwiqenggwdtfvelyg

Timeline for d2ponb_:

• d2ponb_ first appeared in SCOP 1.75, called d2ponb1
  
• d2ponb_ appears in SCOPe 2.04
  
• d2ponb_ appears in SCOPe 2.06
  
• d2ponb_ appears in the current release, SCOPe 2.08