Lineage for d2ponb1 (2pon B:57-212)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058005Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1058045Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (1 family) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1058046Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1058052Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 1058053Species Human (Homo sapiens) [TaxId:9606] [56857] (21 PDB entries)
  8. 1058074Domain d2ponb1: 2pon B:57-212 [149723]
    automatically matched to d1g5ja_

Details for d2ponb1

PDB Entry: 2pon (more details)

PDB Description: solution structure of the bcl-xl/beclin-1 complex
PDB Compounds: (B:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d2ponb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ponb1 f.1.4.1 (B:57-212) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelr
yrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
vlvsriaawmatylndhlepwiqenggwdtfvelyg

SCOPe Domain Coordinates for d2ponb1:

Click to download the PDB-style file with coordinates for d2ponb1.
(The format of our PDB-style files is described here.)

Timeline for d2ponb1: