Lineage for d2ponb_ (2pon B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021136Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 3021137Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries)
  8. 3021230Domain d2ponb_: 2pon B: [149723]
    automated match to d3sp7a_

Details for d2ponb_

PDB Entry: 2pon (more details)

PDB Description: solution structure of the bcl-xl/beclin-1 complex
PDB Compounds: (B:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d2ponb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ponb_ f.1.4.1 (B:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelr
yrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
vlvsriaawmatylndhlepwiqenggwdtfvelyg

SCOPe Domain Coordinates for d2ponb_:

Click to download the PDB-style file with coordinates for d2ponb_.
(The format of our PDB-style files is described here.)

Timeline for d2ponb_: