Lineage for d2poga_ (2pog A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008578Protein Estrogen receptor alpha [48519] (1 species)
  7. 2008579Species Human (Homo sapiens) [TaxId:9606] [48520] (64 PDB entries)
    Uniprot P03372 307-551
  8. 2008600Domain d2poga_: 2pog A: [149721]
    automated match to d1qkta_
    complexed with wst

Details for d2poga_

PDB Entry: 2pog (more details), 1.84 Å

PDB Description: benzopyrans as selective estrogen receptor b agonists (serbas). part 2: structure activity relationship studies on the benzopyran scaffold.
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d2poga_:

Sequence, based on SEQRES records: (download)

>d2poga_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllemld
ahrlh

Sequence, based on observed residues (ATOM records): (download)

>d2poga_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseyasmmglltnladrelvhminwakrvpgfvdltlh
dqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatss
rfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihlmaka
gltlqqqhqrlaqlllilshirhmsnkgmehlysmkvplydlllemldahrlh

SCOPe Domain Coordinates for d2poga_:

Click to download the PDB-style file with coordinates for d2poga_.
(The format of our PDB-style files is described here.)

Timeline for d2poga_: