![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.4: CDH-like [159882] (1 protein) Pfam PF02611; CDP-diacylglycerol pyrophosphatase; duplication: consists of the N-terminal HIT subdomain and C-terminal rudiment HIT-like subdomain |
![]() | Protein CDP-diacylglycerol pyrophosphatase CDH [159883] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [159884] (1 PDB entry) Uniprot Q8X7A5 31-250 |
![]() | Domain d2pofb_: 2pof B: [149720] automated match to d2pofa1 |
PDB Entry: 2pof (more details), 1.4 Å
SCOPe Domain Sequences for d2pofb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pofb_ d.13.1.4 (B:) CDP-diacylglycerol pyrophosphatase CDH {Escherichia coli [TaxId: 562]} sdtlrkivleeclpnqqqnqnpspcaevkpnagyvvlkdlngplqyllmptyringtesp lltdpstpnffwlawqardfmskkygqpvpdravslainsrtgrtqnhfhihiscirpdv reqldnnlanissrwlplpgglrgheylarrvteselvqrspfmmlaeevpearehmgsy glamvrqsdnsfvllatqrnlltlnrasaeeiqdhqceil
Timeline for d2pofb_: