| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein CD1, alpha-3 domain [88615] (5 species) |
| Species Human (Homo sapiens), CD1d [TaxId:9606] [158876] (2 PDB entries) Uniprot P15813 202-295 |
| Domain d2po6e1: 2po6 E:184-277 [149713] Other proteins in same PDB: d2po6a2, d2po6a3, d2po6b1, d2po6e2, d2po6f1 automatically matched to 1ZT4 A:184-277 complexed with agh, nag |
PDB Entry: 2po6 (more details), 3.2 Å
SCOPe Domain Sequences for d2po6e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2po6e1 b.1.1.2 (E:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1d [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw
Timeline for d2po6e1: