Lineage for d2po6e1 (2po6 E:184-277)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291386Protein CD1, alpha-3 domain [88615] (5 species)
  7. 1291410Species Human (Homo sapiens), CD1d [TaxId:9606] [158876] (2 PDB entries)
    Uniprot P15813 202-295
  8. 1291412Domain d2po6e1: 2po6 E:184-277 [149713]
    Other proteins in same PDB: d2po6a2, d2po6b1, d2po6e2, d2po6f1
    automatically matched to 1ZT4 A:184-277
    complexed with agh, nag

Details for d2po6e1

PDB Entry: 2po6 (more details), 3.2 Å

PDB Description: crystal structure of cd1d-lipid-antigen complexed with beta-2- microglobulin, nkt15 alpha-chain and nkt15 beta-chain
PDB Compounds: (E:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d2po6e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2po6e1 b.1.1.2 (E:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1d [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

SCOPe Domain Coordinates for d2po6e1:

Click to download the PDB-style file with coordinates for d2po6e1.
(The format of our PDB-style files is described here.)

Timeline for d2po6e1: