SCOPe 2.08: Domain d2po6e1: 2po6 E:184-277

Lineage for d2po6e1 (2po6 E:184-277)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein CD1, alpha-3 domain [88615] (5 species)
Species Human (Homo sapiens), CD1d [TaxId:9606] [158876] (2 PDB entries)
Uniprot P15813 202-295
Domain d2po6e1: 2po6 E:184-277 [149713]
Other proteins in same PDB: d2po6a2, d2po6a3, d2po6b1, d2po6e2, d2po6f1
automatically matched to 1ZT4 A:184-277
complexed with agh, nag

Details for d2po6e1

PDB Entry: 2po6 (more details), 3.2 Å

PDB Description: crystal structure of cd1d-lipid-antigen complexed with beta-2- microglobulin, nkt15 alpha-chain and nkt15 beta-chain

PDB Compounds: (E:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d2po6e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2po6e1 b.1.1.2 (E:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1d [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

SCOPe Domain Coordinates for d2po6e1:

Click to download the PDB-style file with coordinates for d2po6e1.
(The format of our PDB-style files is described here.)

Timeline for d2po6e1: