SCOPe 2.04: Domain d2po6a2: 2po6 A:6-183

Lineage for d2po6a2 (2po6 A:6-183)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1d [TaxId:9606] [160079] (2 PDB entries)
   Uniprot P15813 24-201

8. Domain d2po6a2: 2po6 A:6-183 [149711]
   Other proteins in same PDB: d2po6a1, d2po6b1, d2po6e1, d2po6f1
   automatically matched to 1ZT4 A:6-183
   complexed with agh, nag

Details for d2po6a2

PDB Entry: 2po6, 3.2 Å

PDB Description: crystal structure of cd1d-lipid-antigen complexed with beta-2- microglobulin, nkt15 alpha-chain and nkt15 beta-chain

PDB Compounds: (A:) T-cell surface glycoprotein CD1d

SCOPe Domain Sequences for d2po6a2:

Sequence; same for both SEQRES and ATOM records:

>d2po6a2 d.19.1.1 (A:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1d [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdils
fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

Timeline for d2po6a2:

• d2po6a2 first appeared in SCOP 1.75
  
• d2po6a2 appears in SCOPe 2.03
  
• d2po6a2 appears in SCOPe 2.05
  
• d2po6a2 appears in the current release, SCOPe 2.08