Lineage for d2po6a1 (2po6 A:184-277)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784362Protein CD1, alpha-3 domain [88615] (4 species)
  7. 784373Species Human (Homo sapiens), CD1d [TaxId:9606] [158876] (2 PDB entries)
    Uniprot P15813 202-295
  8. 784374Domain d2po6a1: 2po6 A:184-277 [149710]
    Other proteins in same PDB: d2po6a2, d2po6b1, d2po6e2, d2po6f1
    automatically matched to 1ZT4 A:184-277
    complexed with agh, man, nag

Details for d2po6a1

PDB Entry: 2po6 (more details), 3.2 Å

PDB Description: crystal structure of cd1d-lipid-antigen complexed with beta-2- microglobulin, nkt15 alpha-chain and nkt15 beta-chain
PDB Compounds: (A:) T-cell surface glycoprotein CD1d

SCOP Domain Sequences for d2po6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2po6a1 b.1.1.2 (A:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1d [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

SCOP Domain Coordinates for d2po6a1:

Click to download the PDB-style file with coordinates for d2po6a1.
(The format of our PDB-style files is described here.)

Timeline for d2po6a1: