SCOP 1.75: Domain d2pnxc1: 2pnx C:195-244

Lineage for d2pnxc1 (2pnx C:195-244)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families)

5. Family g.50.1.2: PHD domain [57911] (13 proteins)

6. Protein Inhibitor of growth protein 4, Ing4 [118334] (2 species)

7. Species Homo sapiens [TaxId:9606] [161223] (3 PDB entries)

8. Domain d2pnxc1: 2pnx C:195-244 [149709]
   automatically matched to d1wena_
   complexed with m3l, zn

Details for d2pnxc1

PDB Entry: 2pnx, 1.8 Å

PDB Description: The PHD finger of ING4 in complex with an H3K4Me3 histone peptide

PDB Compounds: (C:) Inhibitor of growth protein 4

SCOP Domain Sequences for d2pnxc1:

Sequence; same for both SEQRES and ATOM records:

>d2pnxc1 g.50.1.2 (C:195-244) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]}
eptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsq

Timeline for d2pnxc1:

• d2pnxc1 is new in SCOP 1.75
  
• d2pnxc1 appears in SCOPe 2.01
  
• d2pnxc1 appears in the current release, SCOPe 2.08