SCOPe 2.08: Domain d2pnxa1: 2pnx A:195-245

Lineage for d2pnxa1 (2pnx A:195-245)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein Inhibitor of growth protein 4, Ing4 [118334] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161223] (3 PDB entries)

8. Domain d2pnxa1: 2pnx A:195-245 [149708]
   automatically matched to d1wena_
   complexed with zn

Details for d2pnxa1

PDB Entry: 2pnx, 1.8 Å

PDB Description: The PHD finger of ING4 in complex with an H3K4Me3 histone peptide

PDB Compounds: (A:) Inhibitor of growth protein 4

SCOPe Domain Sequences for d2pnxa1:

Sequence; same for both SEQRES and ATOM records:

>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Human (Homo sapiens) [TaxId: 9606]}
eptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqe

Timeline for d2pnxa1:

• d2pnxa1 first appeared in SCOP 1.75
  
• d2pnxa1 appears in SCOPe 2.07