Lineage for d2pnxa1 (2pnx A:195-245)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588901Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2588902Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2588925Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 2588929Protein Inhibitor of growth protein 4, Ing4 [118334] (2 species)
  7. 2588930Species Human (Homo sapiens) [TaxId:9606] [161223] (3 PDB entries)
  8. 2588931Domain d2pnxa1: 2pnx A:195-245 [149708]
    automatically matched to d1wena_
    complexed with zn

Details for d2pnxa1

PDB Entry: 2pnx (more details), 1.8 Å

PDB Description: The PHD finger of ING4 in complex with an H3K4Me3 histone peptide
PDB Compounds: (A:) Inhibitor of growth protein 4

SCOPe Domain Sequences for d2pnxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Human (Homo sapiens) [TaxId: 9606]}
eptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqe

SCOPe Domain Coordinates for d2pnxa1:

Click to download the PDB-style file with coordinates for d2pnxa1.
(The format of our PDB-style files is described here.)

Timeline for d2pnxa1: