Lineage for d2pnrg_ (2pnr G:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332005Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1332006Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 1332007Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)
  6. 1332019Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
    component of the pyruvate dehydrogenase complex
  7. 1332028Species Human (Homo sapiens) [TaxId:9606] [51242] (8 PDB entries)
  8. 1332031Domain d2pnrg_: 2pnr G: [149705]
    Other proteins in same PDB: d2pnra1, d2pnra2, d2pnrb1, d2pnrb2, d2pnre1, d2pnre2, d2pnrf1, d2pnrf2
    automated match to d1fyca_
    complexed with red

Details for d2pnrg_

PDB Entry: 2pnr (more details), 2.5 Å

PDB Description: Crystal Structure of the asymmetric Pdk3-l2 Complex
PDB Compounds: (G:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOPe Domain Sequences for d2pnrg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnrg_ b.84.1.1 (G:) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}
vllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegylakilvpeg
trdvplgtplciivekead

SCOPe Domain Coordinates for d2pnrg_:

Click to download the PDB-style file with coordinates for d2pnrg_.
(The format of our PDB-style files is described here.)

Timeline for d2pnrg_: