![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
![]() | Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
![]() | Protein Lipoyl domain of the 2-oxoglutarate dehydrogenase complex [51243] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [159320] (2 PDB entries) |
![]() | Domain d2pnrg1: 2pnr G:135-195 [149705] Other proteins in same PDB: d2pnra1, d2pnra2, d2pnrb1, d2pnrb2, d2pnre1, d2pnre2, d2pnrf1, d2pnrf2 automatically matched to d1pmra_ complexed with red |
PDB Entry: 2pnr (more details), 2.5 Å
SCOPe Domain Sequences for d2pnrg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pnrg1 b.84.1.1 (G:135-195) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Human (Homo sapiens) [TaxId: 9606]} vllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegylakilvpeg t
Timeline for d2pnrg1: