Lineage for d2pnre2 (2pnr E:177-301)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1039421Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1039422Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 1039740Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (2 proteins)
  6. 1039746Protein Pyruvate dehydrogenase kinase [69807] (2 species)
  7. 1039747Species Human (Homo sapiens) [TaxId:9606] [160702] (5 PDB entries)
    Uniprot Q15120 177-301
  8. 1039750Domain d2pnre2: 2pnr E:177-301 [149702]
    Other proteins in same PDB: d2pnra1, d2pnrb1, d2pnrc1, d2pnre1, d2pnrf1, d2pnrg1
    automatically matched to 1Y8N A:177-301
    complexed with red

Details for d2pnre2

PDB Entry: 2pnr (more details), 2.5 Å

PDB Description: Crystal Structure of the asymmetric Pdk3-l2 Complex
PDB Compounds: (E:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3

SCOPe Domain Sequences for d2pnre2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnre2 d.122.1.4 (E:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
npvhpkhigsidptcnvadvvkdayetakmlceqyylvapeleveefnakapdkpiqvvy
vpshlfhmlfelfknsmratvelyedrkegypavktlvtlgkedlsikisdlgggvplrk
idrlf

SCOPe Domain Coordinates for d2pnre2:

Click to download the PDB-style file with coordinates for d2pnre2.
(The format of our PDB-style files is described here.)

Timeline for d2pnre2: