Lineage for d2pnre1 (2pnr E:13-176)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912955Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 913171Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (1 family) (S)
  5. 913172Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (2 proteins)
  6. 913178Protein Pyruvate dehydrogenase kinase [69016] (2 species)
  7. 913179Species Human (Homo sapiens) [TaxId:9606] [158429] (5 PDB entries)
    Uniprot Q15120 13-176
  8. 913182Domain d2pnre1: 2pnr E:13-176 [149701]
    Other proteins in same PDB: d2pnra2, d2pnrb2, d2pnrc1, d2pnre2, d2pnrf2, d2pnrg1
    automatically matched to 1Y8N A:13-176
    complexed with red

Details for d2pnre1

PDB Entry: 2pnr (more details), 2.5 Å

PDB Description: Crystal Structure of the asymmetric Pdk3-l2 Complex
PDB Compounds: (E:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3

SCOPe Domain Sequences for d2pnre1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnre1 a.29.5.1 (E:13-176) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]}
pkqierysrfspsplsikqfldfgrdnacektsymflrkelpvrlantmrevnllpdnll
nrpsvglvqswymqsflelleyenkspedpqvldnflqvlikvrnrhndvvptmaqgvie
ykekfgfdpfistniqyfldrfytnrisfrmlinqhtllfggdt

SCOPe Domain Coordinates for d2pnre1:

Click to download the PDB-style file with coordinates for d2pnre1.
(The format of our PDB-style files is described here.)

Timeline for d2pnre1: