SCOP 1.75: Domain d2pnrc1: 2pnr C:135-195

Lineage for d2pnrc1 (2pnr C:135-195)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (1 family)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)

6. Protein Lipoyl domain of the 2-oxoglutarate dehydrogenase complex [51243] (3 species)

7. Species Homo sapiens [TaxId:9606] [159320] (2 PDB entries)

8. Domain d2pnrc1: 2pnr C:135-195 [149700]
   Other proteins in same PDB: d2pnra1, d2pnra2, d2pnrb1, d2pnrb2, d2pnre1, d2pnre2, d2pnrf1, d2pnrf2
   automatically matched to d1pmra_
   complexed with red

Details for d2pnrc1

PDB Entry: 2pnr, 2.5 Å

PDB Description: Crystal Structure of the asymmetric Pdk3-l2 Complex

PDB Compounds: (C:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOP Domain Sequences for d2pnrc1:

Sequence; same for both SEQRES and ATOM records:

>d2pnrc1 b.84.1.1 (C:135-195) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Homo sapiens [TaxId: 9606]}
vllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegylakilvpeg
t

Timeline for d2pnrc1:

• d2pnrc1 is new in SCOP 1.75
  
• d2pnrc1 appears in SCOPe 2.01
  
• d2pnrc1 appears in the current release, SCOPe 2.08, called d2pnrc_