Lineage for d2pnrc1 (2pnr C:135-195)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810794Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 810795Superfamily b.84.1: Single hybrid motif [51230] (1 family) (S)
    7 to 8 strands in 2 beta-sheets
  5. 810796Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 protein domains)
  6. 810824Protein Lipoyl domain of the 2-oxoglutarate dehydrogenase complex [51243] (3 species)
  7. 810830Species Homo sapiens [TaxId:9606] [159320] (2 PDB entries)
  8. 810831Domain d2pnrc1: 2pnr C:135-195 [149700]
    Other proteins in same PDB: d2pnra1, d2pnra2, d2pnrb1, d2pnrb2, d2pnre1, d2pnre2, d2pnrf1, d2pnrf2
    automatically matched to d1pmra_
    complexed with red

Details for d2pnrc1

PDB Entry: 2pnr (more details), 2.5 Å

PDB Description: Crystal Structure of the asymmetric Pdk3-l2 Complex
PDB Compounds: (C:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOP Domain Sequences for d2pnrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnrc1 b.84.1.1 (C:135-195) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Homo sapiens [TaxId: 9606]}
vllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegylakilvpeg
t

SCOP Domain Coordinates for d2pnrc1:

Click to download the PDB-style file with coordinates for d2pnrc1.
(The format of our PDB-style files is described here.)

Timeline for d2pnrc1: