Lineage for d2pnol1 (2pno L:2-147)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028966Fold f.56: MAPEG domain-like [161083] (1 superfamily)
    4 helices, bundle; left-handed superhelix
  4. 3028967Superfamily f.56.1: MAPEG domain-like [161084] (2 families) (S)
  5. 3028968Family f.56.1.1: MAPEG domain [161085] (3 proteins)
    Pfam PF01124
  6. 3028983Protein Leukotriene C4 synthase [161090] (1 species)
  7. 3028984Species Human (Homo sapiens) [TaxId:9606] [161091] (4 PDB entries)
    Uniprot Q16873 2-147
  8. 3028999Domain d2pnol1: 2pno L:2-147 [149695]
    automatically matched to 2PNO A:2-147
    complexed with gsh, lmt

Details for d2pnol1

PDB Entry: 2pno (more details), 3.3 Å

PDB Description: Crystal structure of human leukotriene C4 synthase
PDB Compounds: (L:) leukotriene c4 synthase

SCOPe Domain Sequences for d2pnol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnol1 f.56.1.1 (L:2-147) Leukotriene C4 synthase {Human (Homo sapiens) [TaxId: 9606]}
kdevallaavtllgvllqayfslqvisarrafrvspplttgppefervyraqvncseyfp
lflatlwvagiffhegaaalcglvylfarlryfqgyarsaqlrlaplyasaralwllval
aalgllahflpaalraallgrlrtll

SCOPe Domain Coordinates for d2pnol1:

Click to download the PDB-style file with coordinates for d2pnol1.
(The format of our PDB-style files is described here.)

Timeline for d2pnol1: