![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.56: MAPEG domain-like [161083] (1 superfamily) 4 helices, bundle; left-handed superhelix |
![]() | Superfamily f.56.1: MAPEG domain-like [161084] (2 families) ![]() |
![]() | Family f.56.1.1: MAPEG domain [161085] (3 proteins) Pfam PF01124 |
![]() | Protein Leukotriene C4 synthase [161090] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [161091] (4 PDB entries) Uniprot Q16873 2-147 |
![]() | Domain d2pnoj1: 2pno J:2-147 [149693] automatically matched to 2PNO A:2-147 complexed with gsh, lmt |
PDB Entry: 2pno (more details), 3.3 Å
SCOPe Domain Sequences for d2pnoj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pnoj1 f.56.1.1 (J:2-147) Leukotriene C4 synthase {Human (Homo sapiens) [TaxId: 9606]} kdevallaavtllgvllqayfslqvisarrafrvspplttgppefervyraqvncseyfp lflatlwvagiffhegaaalcglvylfarlryfqgyarsaqlrlaplyasaralwllval aalgllahflpaalraallgrlrtll
Timeline for d2pnoj1: