Lineage for d2pnoi1 (2pno I:2-147)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2634150Fold f.56: MAPEG domain-like [161083] (1 superfamily)
    4 helices, bundle; left-handed superhelix
  4. 2634151Superfamily f.56.1: MAPEG domain-like [161084] (2 families) (S)
  5. 2634152Family f.56.1.1: MAPEG domain [161085] (3 proteins)
    Pfam PF01124
  6. 2634167Protein Leukotriene C4 synthase [161090] (1 species)
  7. 2634168Species Human (Homo sapiens) [TaxId:9606] [161091] (4 PDB entries)
    Uniprot Q16873 2-147
  8. 2634180Domain d2pnoi1: 2pno I:2-147 [149692]
    automatically matched to 2PNO A:2-147
    complexed with gsh, lmt

Details for d2pnoi1

PDB Entry: 2pno (more details), 3.3 Å

PDB Description: Crystal structure of human leukotriene C4 synthase
PDB Compounds: (I:) leukotriene c4 synthase

SCOPe Domain Sequences for d2pnoi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnoi1 f.56.1.1 (I:2-147) Leukotriene C4 synthase {Human (Homo sapiens) [TaxId: 9606]}
kdevallaavtllgvllqayfslqvisarrafrvspplttgppefervyraqvncseyfp
lflatlwvagiffhegaaalcglvylfarlryfqgyarsaqlrlaplyasaralwllval
aalgllahflpaalraallgrlrtll

SCOPe Domain Coordinates for d2pnoi1:

Click to download the PDB-style file with coordinates for d2pnoi1.
(The format of our PDB-style files is described here.)

Timeline for d2pnoi1: