Lineage for d2pnoe1 (2pno E:2-147)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 888555Fold f.56: MAPEG domain-like [161083] (1 superfamily)
    4 helices, bundle; left-handed superhelix
  4. 888556Superfamily f.56.1: MAPEG domain-like [161084] (1 family) (S)
  5. 888557Family f.56.1.1: MAPEG domain [161085] (3 proteins)
    Pfam PF01124
  6. 888572Protein Leukotriene C4 synthase [161090] (1 species)
  7. 888573Species Human (Homo sapiens) [TaxId:9606] [161091] (3 PDB entries)
    Uniprot Q16873 2-147
  8. 888580Domain d2pnoe1: 2pno E:2-147 [149688]
    automatically matched to 2PNO A:2-147
    complexed with gtt, lmt

Details for d2pnoe1

PDB Entry: 2pno (more details), 3.3 Å

PDB Description: Crystal structure of human leukotriene C4 synthase
PDB Compounds: (E:) leukotriene c4 synthase

SCOP Domain Sequences for d2pnoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pnoe1 f.56.1.1 (E:2-147) Leukotriene C4 synthase {Human (Homo sapiens) [TaxId: 9606]}
kdevallaavtllgvllqayfslqvisarrafrvspplttgppefervyraqvncseyfp
lflatlwvagiffhegaaalcglvylfarlryfqgyarsaqlrlaplyasaralwllval
aalgllahflpaalraallgrlrtll

SCOP Domain Coordinates for d2pnoe1:

Click to download the PDB-style file with coordinates for d2pnoe1.
(The format of our PDB-style files is described here.)

Timeline for d2pnoe1: