Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
Fold f.56: MAPEG domain-like [161083] (1 superfamily) 4 helices, bundle; left-handed superhelix |
Superfamily f.56.1: MAPEG domain-like [161084] (1 family) |
Family f.56.1.1: MAPEG domain [161085] (3 proteins) Pfam PF01124 |
Protein Leukotriene C4 synthase [161090] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [161091] (3 PDB entries) Uniprot Q16873 2-147 |
Domain d2pnoe1: 2pno E:2-147 [149688] automatically matched to 2PNO A:2-147 complexed with gtt, lmt |
PDB Entry: 2pno (more details), 3.3 Å
SCOP Domain Sequences for d2pnoe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pnoe1 f.56.1.1 (E:2-147) Leukotriene C4 synthase {Human (Homo sapiens) [TaxId: 9606]} kdevallaavtllgvllqayfslqvisarrafrvspplttgppefervyraqvncseyfp lflatlwvagiffhegaaalcglvylfarlryfqgyarsaqlrlaplyasaralwllval aalgllahflpaalraallgrlrtll
Timeline for d2pnoe1: