SCOP 1.75: Domain d2pmsc1: 2pms C:167-288

Lineage for d2pmsc1 (2pms C:167-288)

1. Root: SCOP 1.75

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.4: Antiparallel coiled-coil [58086] (17 superfamilies)
   this is not a true fold; contains at least two very long antiparallel helices

4. Superfamily h.4.19: PspA lactotransferrin-binding region [161270] (1 family)
   3 helices, the middle one is longer than the two others

5. Family h.4.19.1: PspA lactotransferrin-binding region [161271] (1 protein)

6. Protein Pneumococcal surface protein A, PspA [161272] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [161273] (1 PDB entry)
   Uniprot Q8DRI0 198-319

8. Domain d2pmsc1: 2pms C:167-288 [149671]

Details for d2pmsc1

PDB Entry: 2pms, 2.91 Å

PDB Description: crystal structure of the complex of human lactoferrin n-lobe and lactoferrin-binding domain of pneumococcal surface protein a

PDB Compounds: (C:) pneumococcal surface protein a (pspa)

SCOP Domain Sequences for d2pmsc1:

Sequence, based on SEQRES records:

>d2pmsc1 h.4.19.1 (C:167-288) Pneumococcal surface protein A, PspA {Streptococcus pneumoniae [TaxId: 1313]}
mdaeevapqakiaelenqvhrleqelkeidesesedyakegfraplqskldakkaklskl
eelsdkideldaeiakledqlkaaeennnvedyfkeglektiaakkaelekteadlkkav
ne

Sequence, based on observed residues (ATOM records):

>d2pmsc1 h.4.19.1 (C:167-288) Pneumococcal surface protein A, PspA {Streptococcus pneumoniae [TaxId: 1313]}
mdaeevapqakiaelenqvhrleqelkeideaplqskldakkaklskleelsdkidelda
eiakledqlkaaeeedyfkeglektiaakkaelekteadlkkavne

Timeline for d2pmsc1:

• d2pmsc1 is new in SCOP 1.75
  
• d2pmsc1 appears in SCOPe 2.01
  
• d2pmsc1 appears in the current release, SCOPe 2.08