Lineage for d2pmsc1 (2pms C:167-288)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 896123Fold h.4: Antiparallel coiled-coil [58086] (17 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 896252Superfamily h.4.19: PspA lactotransferrin-binding region [161270] (1 family) (S)
    3 helices, the middle one is longer than the two others
  5. 896253Family h.4.19.1: PspA lactotransferrin-binding region [161271] (1 protein)
  6. 896254Protein Pneumococcal surface protein A, PspA [161272] (1 species)
  7. 896255Species Streptococcus pneumoniae [TaxId:1313] [161273] (1 PDB entry)
    Uniprot Q8DRI0 198-319
  8. 896256Domain d2pmsc1: 2pms C:167-288 [149671]

Details for d2pmsc1

PDB Entry: 2pms (more details), 2.91 Å

PDB Description: crystal structure of the complex of human lactoferrin n-lobe and lactoferrin-binding domain of pneumococcal surface protein a
PDB Compounds: (C:) pneumococcal surface protein a (pspa)

SCOP Domain Sequences for d2pmsc1:

Sequence, based on SEQRES records: (download)

>d2pmsc1 h.4.19.1 (C:167-288) Pneumococcal surface protein A, PspA {Streptococcus pneumoniae [TaxId: 1313]}
mdaeevapqakiaelenqvhrleqelkeidesesedyakegfraplqskldakkaklskl
eelsdkideldaeiakledqlkaaeennnvedyfkeglektiaakkaelekteadlkkav
ne

Sequence, based on observed residues (ATOM records): (download)

>d2pmsc1 h.4.19.1 (C:167-288) Pneumococcal surface protein A, PspA {Streptococcus pneumoniae [TaxId: 1313]}
mdaeevapqakiaelenqvhrleqelkeideaplqskldakkaklskleelsdkidelda
eiakledqlkaaeeedyfkeglektiaakkaelekteadlkkavne

SCOP Domain Coordinates for d2pmsc1:

Click to download the PDB-style file with coordinates for d2pmsc1.
(The format of our PDB-style files is described here.)

Timeline for d2pmsc1: