| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.11: AF1782-like [158372] (1 family) ![]() automatically mapped to Pfam PF04010 |
| Family a.8.11.1: AF1782-like [158373] (3 proteins) Pfam PF04010; DUF357 |
| Protein Uncharacterized protein MTH1690 [158376] (1 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [158377] (1 PDB entry) Uniprot O27725 3-77 |
| Domain d2pmra1: 2pmr A:3-77 [149670] Other proteins in same PDB: d2pmra2 |
PDB Entry: 2pmr (more details), 1.32 Å
SCOPe Domain Sequences for d2pmra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pmra1 a.8.11.1 (A:3-77) Uncharacterized protein MTH1690 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
creriekdlelleknlmemksiklsddeeavveralnyrddsvyylekgdhitsfgcity
ahglldslrmlhrii
Timeline for d2pmra1: