Lineage for d2pmra1 (2pmr A:3-77)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2697332Superfamily a.8.11: AF1782-like [158372] (1 family) (S)
    automatically mapped to Pfam PF04010
  5. 2697333Family a.8.11.1: AF1782-like [158373] (3 proteins)
    Pfam PF04010; DUF357
  6. 2697337Protein Uncharacterized protein MTH1690 [158376] (1 species)
  7. 2697338Species Methanobacterium thermoautotrophicum [TaxId:145262] [158377] (1 PDB entry)
    Uniprot O27725 3-77
  8. 2697339Domain d2pmra1: 2pmr A:3-77 [149670]
    Other proteins in same PDB: d2pmra2

Details for d2pmra1

PDB Entry: 2pmr (more details), 1.32 Å

PDB Description: crystal structure of a protein of unknown function from methanobacterium thermoautotrophicum
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2pmra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmra1 a.8.11.1 (A:3-77) Uncharacterized protein MTH1690 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
creriekdlelleknlmemksiklsddeeavveralnyrddsvyylekgdhitsfgcity
ahglldslrmlhrii

SCOPe Domain Coordinates for d2pmra1:

Click to download the PDB-style file with coordinates for d2pmra1.
(The format of our PDB-style files is described here.)

Timeline for d2pmra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pmra2