SCOPe 2.08: Domain d2pmdb1: 2pmd B:207-320

Lineage for d2pmdb1 (2pmd B:207-320)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (11 proteins)

6. Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [141335] (10 PDB entries)
   Uniprot Q980A5 207-320

8. Domain d2pmdb1: 2pmd B:207-320 [149666]
   Other proteins in same PDB: d2pmda2, d2pmda3, d2pmdb2, d2pmdb3
   automated match to d2qn6a1
   complexed with gdp, gnp, ppv

Details for d2pmdb1

PDB Entry: 2pmd, 2.65 Å

PDB Description: the structures of aif2gamma subunit from the archaeon sulfolobus solfataricus in the gdp-bound form.

PDB Compounds: (B:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d2pmdb1:

Sequence; same for both SEQRES and ATOM records:

>d2pmdb1 b.43.3.1 (B:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

Timeline for d2pmdb1:

• d2pmdb1 first appeared in SCOP 1.75
  
• d2pmdb1 appears in SCOPe 2.07