Lineage for d2pmda1 (2pmd A:207-320)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801236Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 801237Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 801362Protein Initiation factor eIF2 gamma subunit, domain II [74962] (3 species)
  7. 801371Species Sulfolobus solfataricus [TaxId:2287] [141335] (5 PDB entries)
    Uniprot Q980A5 207-320
  8. 801373Domain d2pmda1: 2pmd A:207-320 [149663]
    Other proteins in same PDB: d2pmda2, d2pmda3, d2pmdb2, d2pmdb3
    automatically matched to d2ahoa1
    complexed with gdp, gnp, ppv

Details for d2pmda1

PDB Entry: 2pmd (more details), 2.65 Å

PDB Description: the structures of aif2gamma subunit from the archaeon sulfolobus solfataricus in the gdp-bound form.
PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOP Domain Sequences for d2pmda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmda1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]}
rdlsqkpvmlvirsfdvnkpgtqfnelkggviggsiiqglfkvdqeikvlpglrvekqgk
vsyepiftkissirfgdeefkeakpgglvaigtyldpsltkadnllgsiitlad

SCOP Domain Coordinates for d2pmda1:

Click to download the PDB-style file with coordinates for d2pmda1.
(The format of our PDB-style files is described here.)

Timeline for d2pmda1: