SCOPe 2.07: Domain d2pmcb_: 2pmc B:

Lineage for d2pmcb_ (2pmc B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Salmonella typhimurium [TaxId:90371] [52176] (13 PDB entries)

8. Domain d2pmcb_: 2pmc B: [149660]
   automated match to d2chea_
   complexed with mg

Details for d2pmcb_

PDB Entry: 2pmc, 2.69 Å

PDB Description: crystal structure of chey-mg(2+) in complex with chez(c15) peptide solved from a p1 crystal

PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d2pmcb_:

Sequence; same for both SEQRES and ATOM records:

>d2pmcb_ c.23.1.1 (B:) CheY protein {Salmonella typhimurium [TaxId: 90371]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d2pmcb_:

• d2pmcb_ first appeared in SCOP 1.75, called d2pmcb1
  
• d2pmcb_ appears in SCOPe 2.06
  
• d2pmcb_ appears in the current release, SCOPe 2.08