| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (2 proteins) |
| Domain d2plya4: 2ply A:575-632 [149654] automatically matched to d1lvaa4 protein/RNA complex; complexed with ca, cl, mg, na |
PDB Entry: 2ply (more details), 2.6 Å
SCOPe Domain Sequences for d2plya4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2plya4 a.4.5.35 (A:575-632) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
qalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrvvv
Timeline for d2plya4: