Lineage for d2plya4 (2ply A:575-632)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306602Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (2 protein domains)
  6. Protein C-terminal fragment of elongation factor SelB [74684] (1 species)
    duplication: tandem repeat of four "winged helix" domains
  7. Species Moorella thermoacetica [TaxId:1525] [74685] (4 PDB entries)
  8. 2306626Domain d2plya4: 2ply A:575-632 [149654]
    automatically matched to d1lvaa4
    protein/RNA complex; complexed with ca, cl, mg, na

Details for d2plya4

PDB Entry: 2ply (more details), 2.6 Å

PDB Description: Structure of the mRNA binding fragment of elongation factor SelB in complex with SECIS RNA.
PDB Compounds: (A:) Selenocysteine-specific elongation factor

SCOPe Domain Sequences for d2plya4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plya4 a.4.5.35 (A:575-632) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
qalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrvvv

SCOPe Domain Coordinates for d2plya4:

Click to download the PDB-style file with coordinates for d2plya4.
(The format of our PDB-style files is described here.)

Timeline for d2plya4: