| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (2 proteins) |
| Domain d2plya1: 2ply A:392-437 [149651] automatically matched to d1lvaa1 protein/RNA complex; complexed with ca, cl, mg, na fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2ply (more details), 2.6 Å
SCOPe Domain Sequences for d2plya1:
Sequence, based on SEQRES records: (download)
>d2plya1 a.4.5.35 (A:392-437) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
egldwqeaatraslsleetrkllqsmaaagqvtllrvendlyaist
>d2plya1 a.4.5.35 (A:392-437) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
egldvtllrvdlyaist
Timeline for d2plya1: