Lineage for d2plxa1 (2plx A:16-245)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319321Protein Trypsin(ogen) [50515] (9 species)
  7. 1319339Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
    Uniprot P00760
  8. 1319427Domain d2plxa1: 2plx A:16-245 [149650]
    automatically matched to d1tgsz_
    complexed with ca, flc, gol

Details for d2plxa1

PDB Entry: 2plx (more details), 1.56 Å

PDB Description: trypsin complexed to a synthetic peptide from veronica hederifolia
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d2plxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plxa1 b.47.1.2 (A:16-245) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d2plxa1:

Click to download the PDB-style file with coordinates for d2plxa1.
(The format of our PDB-style files is described here.)

Timeline for d2plxa1: