Lineage for d2plsl2 (2pls L:346-428)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987644Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
    Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain
  6. 2987649Protein Hypothetical protein CT0541 [160823] (1 species)
  7. 2987650Species Chlorobium tepidum [TaxId:1097] [160824] (1 PDB entry)
    Uniprot Q8KEZ1 345-428
  8. 2987662Domain d2plsl2: 2pls L:346-428 [149649]
    Other proteins in same PDB: d2plsa2, d2plsb3, d2plsc3, d2plsd3, d2plse3, d2plsf3, d2plsg3, d2plsh3, d2plsi3, d2plsj3, d2plsk3, d2plsl3
    automated match to d2plsi_
    complexed with act, edo, fmt, mg

Details for d2plsl2

PDB Entry: 2pls (more details), 2.15 Å

PDB Description: structural genomics, the crystal structure of the corc/hlyc transporter associated domain of a cbs domain protein from chlorobium tepidum tls
PDB Compounds: (L:) CBS domain protein

SCOPe Domain Sequences for d2plsl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plsl2 d.145.1.4 (L:346-428) Hypothetical protein CT0541 {Chlorobium tepidum [TaxId: 1097]}
vqredgswlldgliavpelkdtlglravpeeekgvyhtlsgmimwllgrlpqtgditfwe
nwrlevidmdskridkvlatkid

SCOPe Domain Coordinates for d2plsl2:

Click to download the PDB-style file with coordinates for d2plsl2.
(The format of our PDB-style files is described here.)

Timeline for d2plsl2: