Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) |
Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins) Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain |
Protein Hypothetical protein CT0541 [160823] (1 species) |
Species Chlorobium tepidum [TaxId:1097] [160824] (1 PDB entry) Uniprot Q8KEZ1 345-428 |
Domain d2plsg2: 2pls G:346-427 [149644] Other proteins in same PDB: d2plsa2, d2plsb3, d2plsc3, d2plsd3, d2plse3, d2plsf3, d2plsg3, d2plsh3, d2plsi3, d2plsj3, d2plsk3, d2plsl3 automated match to d2plsi_ complexed with act, edo, fmt, mg |
PDB Entry: 2pls (more details), 2.15 Å
SCOPe Domain Sequences for d2plsg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2plsg2 d.145.1.4 (G:346-427) Hypothetical protein CT0541 {Chlorobium tepidum [TaxId: 1097]} vqredgswlldgliavpelkdtlglravpeeekgvyhtlsgmimwllgrlpqtgditfwe nwrlevidmdskridkvlatki
Timeline for d2plsg2: