SCOPe 2.08: Domain d2plsf2: 2pls F:346-427

Lineage for d2plsf2 (2pls F:346-427)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
   Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain

6. Protein Hypothetical protein CT0541 [160823] (1 species)

7. Species Chlorobium tepidum [TaxId:1097] [160824] (1 PDB entry)
   Uniprot Q8KEZ1 345-428

8. Domain d2plsf2: 2pls F:346-427 [149643]
   Other proteins in same PDB: d2plsa2, d2plsb3, d2plsc3, d2plsd3, d2plse3, d2plsf3, d2plsg3, d2plsh3, d2plsi3, d2plsj3, d2plsk3, d2plsl3
   automated match to d2plsi_
   complexed with act, edo, fmt, mg

Details for d2plsf2

PDB Entry: 2pls, 2.15 Å

PDB Description: structural genomics, the crystal structure of the corc/hlyc transporter associated domain of a cbs domain protein from chlorobium tepidum tls

PDB Compounds: (F:) CBS domain protein

SCOPe Domain Sequences for d2plsf2:

Sequence; same for both SEQRES and ATOM records:

>d2plsf2 d.145.1.4 (F:346-427) Hypothetical protein CT0541 {Chlorobium tepidum [TaxId: 1097]}
vqredgswlldgliavpelkdtlglravpeeekgvyhtlsgmimwllgrlpqtgditfwe
nwrlevidmdskridkvlatki

Timeline for d2plsf2:

• d2plsf2 first appeared in SCOP 1.75, called d2plsf1
  
• d2plsf2 appears in SCOPe 2.07