Lineage for d2plsb1 (2pls B:345-428)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875230Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 875231Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) (S)
  5. 875354Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
    Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain
  6. 875359Protein Hypothetical protein CT0541 [160823] (1 species)
  7. 875360Species Chlorobium tepidum [TaxId:1097] [160824] (1 PDB entry)
    Uniprot Q8KEZ1 345-428
  8. 875362Domain d2plsb1: 2pls B:345-428 [149639]
    automatically matched to 2PLS A:345-428
    complexed with act, edo, fmt, mg

Details for d2plsb1

PDB Entry: 2pls (more details), 2.15 Å

PDB Description: structural genomics, the crystal structure of the corc/hlyc transporter associated domain of a cbs domain protein from chlorobium tepidum tls
PDB Compounds: (B:) CBS domain protein

SCOP Domain Sequences for d2plsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plsb1 d.145.1.4 (B:345-428) Hypothetical protein CT0541 {Chlorobium tepidum [TaxId: 1097]}
avqredgswlldgliavpelkdtlglravpeeekgvyhtlsgmimwllgrlpqtgditfw
enwrlevidmdskridkvlatkid

SCOP Domain Coordinates for d2plsb1:

Click to download the PDB-style file with coordinates for d2plsb1.
(The format of our PDB-style files is described here.)

Timeline for d2plsb1: