Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) |
Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins) Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain |
Protein Hypothetical protein CT0541 [160823] (1 species) |
Species Chlorobium tepidum [TaxId:1097] [160824] (1 PDB entry) Uniprot Q8KEZ1 345-428 |
Domain d2plsb1: 2pls B:345-428 [149639] automatically matched to 2PLS A:345-428 complexed with act, edo, fmt, mg |
PDB Entry: 2pls (more details), 2.15 Å
SCOP Domain Sequences for d2plsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2plsb1 d.145.1.4 (B:345-428) Hypothetical protein CT0541 {Chlorobium tepidum [TaxId: 1097]} avqredgswlldgliavpelkdtlglravpeeekgvyhtlsgmimwllgrlpqtgditfw enwrlevidmdskridkvlatkid
Timeline for d2plsb1: