SCOPe 2.08: Domain d2plma2: 2plm A:50-330

Lineage for d2plma2 (2plm A:50-330)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.9: SAH/MTA deaminase-like [82258] (3 proteins)
   automatically mapped to Pfam PF01979

6. Protein Hypothetical protein TM0936, probable catalytic domain [82259] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [82260] (3 PDB entries)

8. Domain d2plma2: 2plm A:50-330 [149637]
   Other proteins in same PDB: d2plma1
   automated match to d1p1ma2
   complexed with sib, zn

Details for d2plma2

PDB Entry: 2plm, 2.1 Å

PDB Description: Crystal structure of the protein TM0936 from Thermotoga maritima complexed with ZN and S-inosylhomocysteine

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2plma2:

Sequence; same for both SEQRES and ATOM records:

>d2plma2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima [TaxId: 2336]}
alfnththapmtllrgvaedlsfeewlfskvlpiedrltekmayygtilaqmemarhgia
gfvdmyfheewiakavrdfgmralltrglvdsngddggrleenlklynewngfegrifvg
fgphspylcseeylkrvfdtakslnapvtihlyetskeeydledilniglkevktiaahc
vhlperyfgvlkdipffvshnpasnlklgngiapvqrmiehgmkvtlgtdgaasnnslnl
ffemrlasllqkaqnprnldvntclkmvtydgaqamgfksg

Timeline for d2plma2:

• d2plma2 first appeared in SCOP 1.75
  
• d2plma2 appears in SCOPe 2.07