Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.9: SAH/MTA deaminase-like [82258] (3 proteins) automatically mapped to Pfam PF01979 |
Protein Hypothetical protein TM0936, probable catalytic domain [82259] (1 species) |
Species Thermotoga maritima [TaxId:2336] [82260] (3 PDB entries) |
Domain d2plma2: 2plm A:50-330 [149637] Other proteins in same PDB: d2plma1 automated match to d1p1ma2 complexed with sib, zn |
PDB Entry: 2plm (more details), 2.1 Å
SCOPe Domain Sequences for d2plma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2plma2 c.1.9.9 (A:50-330) Hypothetical protein TM0936, probable catalytic domain {Thermotoga maritima [TaxId: 2336]} alfnththapmtllrgvaedlsfeewlfskvlpiedrltekmayygtilaqmemarhgia gfvdmyfheewiakavrdfgmralltrglvdsngddggrleenlklynewngfegrifvg fgphspylcseeylkrvfdtakslnapvtihlyetskeeydledilniglkevktiaahc vhlperyfgvlkdipffvshnpasnlklgngiapvqrmiehgmkvtlgtdgaasnnslnl ffemrlasllqkaqnprnldvntclkmvtydgaqamgfksg
Timeline for d2plma2: