SCOPe 2.08: Domain d2plma1: 2plm A:1-49,A:331-404

Lineage for d2plma1 (2plm A:1-49,A:331-404)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins)

6. Protein Hypothetical protein TM0936 [82225] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [82226] (3 PDB entries)

8. Domain d2plma1: 2plm A:1-49,A:331-404 [149636]
   Other proteins in same PDB: d2plma2
   automated match to d1p1ma1
   complexed with sib, zn

Details for d2plma1

PDB Entry: 2plm, 2.1 Å

PDB Description: Crystal structure of the protein TM0936 from Thermotoga maritima complexed with ZN and S-inosylhomocysteine

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2plma1:

Sequence; same for both SEQRES and ATOM records:

>d2plma1 b.92.1.4 (A:1-49,A:331-404) Hypothetical protein TM0936 {Thermotoga maritima [TaxId: 2336]}
miignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvmpXkieegwnadl
vvidldlpemfpvqniknhlvhafsgevfatmvagkwiyfdgeyptidseevkrelarie
kely

Timeline for d2plma1:

• d2plma1 first appeared in SCOP 1.75
  
• d2plma1 appears in SCOPe 2.07