Lineage for d2plid_ (2pli D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987644Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
    Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain
  6. 2987697Protein Uncharacterized protein NMB0537 [160835] (1 species)
  7. 2987698Species Neisseria meningitidis [TaxId:487] [160836] (1 PDB entry)
    Uniprot Q9K0P8 191-274
  8. 2987702Domain d2plid_: 2pli D: [149633]
    automated match to d2plia1
    complexed with act, gol, zn

Details for d2plid_

PDB Entry: 2pli (more details), 1.7 Å

PDB Description: Crystal structure of putative Mg2+ and Co2+ transporter(CorC)associated region from Neisseria meningitidis MC58
PDB Compounds: (D:) Uncharacterized protein

SCOPe Domain Sequences for d2plid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2plid_ d.145.1.4 (D:) Uncharacterized protein NMB0537 {Neisseria meningitidis [TaxId: 487]}
dnihavsserwrihaateiedintffgteysseeadtigglviqelghlpvrgekvligg
lqftvaradnrrlhtlmatrv

SCOPe Domain Coordinates for d2plid_:

Click to download the PDB-style file with coordinates for d2plid_.
(The format of our PDB-style files is described here.)

Timeline for d2plid_: