![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins) Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain |
![]() | Protein Uncharacterized protein NMB0537 [160835] (1 species) |
![]() | Species Neisseria meningitidis [TaxId:487] [160836] (1 PDB entry) Uniprot Q9K0P8 191-274 |
![]() | Domain d2plia1: 2pli A:5-88 [149630] complexed with act, gol, zn |
PDB Entry: 2pli (more details), 1.7 Å
SCOPe Domain Sequences for d2plia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2plia1 d.145.1.4 (A:5-88) Uncharacterized protein NMB0537 {Neisseria meningitidis [TaxId: 487]} sadnihavsserwrihaateiedintffgteysseeadtigglviqelghlpvrgekvli gglqftvaradnrrlhtlmatrvk
Timeline for d2plia1: