SCOPe 2.08: Domain d2plga1: 2plg A:4-154

Lineage for d2plga1 (2plg A:4-154)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families)

5. Family d.198.1.2: Tll0839-like [159885] (1 protein)
   Pfam PF08851; DUF1821; cyanobacterial family of similar subunit and dimer structures to the Type III secretory system chaperone from proteobacteria

6. Protein Uncharacterized protein Tll0839 [159886] (1 species)

7. Species Synechococcus elongatus [TaxId:32046] [159887] (1 PDB entry)
   Uniprot Q8DKM0 1-152

8. Domain d2plga1: 2plg A:4-154 [149628]
   Other proteins in same PDB: d2plga2, d2plgb3

Details for d2plga1

PDB Entry: 2plg, 2.6 Å

PDB Description: crystal structure of t110839 protein from synechococcus elongatus

PDB Compounds: (A:) Tll0839 protein

SCOPe Domain Sequences for d2plga1:

Sequence; same for both SEQRES and ATOM records:

>d2plga1 d.198.1.2 (A:4-154) Uncharacterized protein Tll0839 {Synechococcus elongatus [TaxId: 32046]}
tmvsevqpvspasldaplenaveiietvisslhqgdaplvgqtdsgkiwmfrygsaevfv
qlsghteedfltiwspvlplpvadelalyrklltlnwlttfeahfaiaeeqvqvvasrtl
ggitageisrlitivatladdyddalraefk

Timeline for d2plga1:

• d2plga1 first appeared in SCOP 1.75
  
• d2plga1 appears in SCOPe 2.07