| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein CheY protein [52174] (5 species) |
| Species Salmonella typhimurium [TaxId:90371] [52176] (13 PDB entries) |
| Domain d2pl9c_: 2pl9 C: [149624] automated match to d2chea_ complexed with bef, mes, mg |
PDB Entry: 2pl9 (more details), 2.6 Å
SCOPe Domain Sequences for d2pl9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pl9c_ c.23.1.1 (C:) CheY protein {Salmonella typhimurium [TaxId: 90371]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
Timeline for d2pl9c_: