SCOPe 2.06: Domain d2pl9c_: 2pl9 C:

Lineage for d2pl9c_ (2pl9 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Salmonella typhimurium [TaxId:90371] [52176] (13 PDB entries)

8. Domain d2pl9c_: 2pl9 C: [149624]
   automated match to d2chea_
   complexed with bef, mes, mg

Details for d2pl9c_

PDB Entry: 2pl9, 2.6 Å

PDB Description: crystal structure of chey-mg(2+)-bef(3)(-) in complex with chez(c19) peptide solved from a p2(1)2(1)2 crystal

PDB Compounds: (C:) Chemotaxis protein cheY

SCOPe Domain Sequences for d2pl9c_:

Sequence; same for both SEQRES and ATOM records:

>d2pl9c_ c.23.1.1 (C:) CheY protein {Salmonella typhimurium [TaxId: 90371]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d2pl9c_:

• d2pl9c_ first appeared in SCOP 1.75, called d2pl9c1
  
• d2pl9c_ appears in SCOPe 2.05
  
• d2pl9c_ appears in SCOPe 2.07
  
• d2pl9c_ appears in the current release, SCOPe 2.08