Lineage for d2pl9b_ (2pl9 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2114717Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2114728Protein CheY protein [52174] (5 species)
  7. 2114804Species Salmonella typhimurium [TaxId:90371] [52176] (13 PDB entries)
  8. 2114815Domain d2pl9b_: 2pl9 B: [149623]
    automated match to d2chea_
    complexed with bef, mes, mg

Details for d2pl9b_

PDB Entry: 2pl9 (more details), 2.6 Å

PDB Description: crystal structure of chey-mg(2+)-bef(3)(-) in complex with chez(c19) peptide solved from a p2(1)2(1)2 crystal
PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d2pl9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pl9b_ c.23.1.1 (B:) CheY protein {Salmonella typhimurium [TaxId: 90371]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d2pl9b_:

Click to download the PDB-style file with coordinates for d2pl9b_.
(The format of our PDB-style files is described here.)

Timeline for d2pl9b_: