SCOP 1.75: Domain d2pl9a1: 2pl9 A:2-129

Lineage for d2pl9a1 (2pl9 A:2-129)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein CheY protein [52174] (4 species)

7. Species Salmonella typhimurium [TaxId:90371] [52176] (13 PDB entries)

8. Domain d2pl9a1: 2pl9 A:2-129 [149622]
   automatically matched to d2chea_
   complexed with bef, mes, mg

Details for d2pl9a1

PDB Entry: 2pl9, 2.6 Å

PDB Description: crystal structure of chey-mg(2+)-bef(3)(-) in complex with chez(c19) peptide solved from a p2(1)2(1)2 crystal

PDB Compounds: (A:) Chemotaxis protein cheY

SCOP Domain Sequences for d2pl9a1:

Sequence; same for both SEQRES and ATOM records:

>d2pl9a1 c.23.1.1 (A:2-129) CheY protein {Salmonella typhimurium [TaxId: 90371]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d2pl9a1:

• d2pl9a1 is new in SCOP 1.75
  
• d2pl9a1 is called d2pl9a_ in SCOPe 2.01
  
• d2pl9a1 appears in the current release, SCOPe 2.08, called d2pl9a_