Class b: All beta proteins [48724] (174 folds) |
Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily) core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection |
Superfamily b.138.1: Hydrophobin II, HfbII [101751] (1 family) |
Family b.138.1.1: Hydrophobin II, HfbII [101752] (2 proteins) a self-assembling amphiphile |
Protein Hydrophobin II, HfbII [101753] (1 species) |
Species Trichoderma reesei [TaxId:51453] [101754] (5 PDB entries) |
Domain d2pl6d_: 2pl6 D: [149615] automated match to d1r2ma_ complexed with htg |
PDB Entry: 2pl6 (more details), 2.2 Å
SCOPe Domain Sequences for d2pl6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pl6d_ b.138.1.1 (D:) Hydrophobin II, HfbII {Trichoderma reesei [TaxId: 51453]} avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq allcqkaigtf
Timeline for d2pl6d_: