Lineage for d2pl6d1 (2pl6 D:1-70)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813621Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily)
    core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection
  4. 813622Superfamily b.138.1: Hydrophobin II, HfbII [101751] (1 family) (S)
  5. 813623Family b.138.1.1: Hydrophobin II, HfbII [101752] (1 protein)
    a self-assembling amphiphile
  6. 813624Protein Hydrophobin II, HfbII [101753] (1 species)
  7. 813625Species Trichoderma reesei [TaxId:51453] [101754] (4 PDB entries)
  8. 813635Domain d2pl6d1: 2pl6 D:1-70 [149615]
    automatically matched to d1r2ma_
    complexed with htg

Details for d2pl6d1

PDB Entry: 2pl6 (more details), 2.2 Å

PDB Description: monoclinic crystal structure of hydrophobin hfbii in presence of a detergent
PDB Compounds: (D:) Hydrophobin-2

SCOP Domain Sequences for d2pl6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pl6d1 b.138.1.1 (D:1-70) Hydrophobin II, HfbII {Trichoderma reesei [TaxId: 51453]}
avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
allcqkaigt

SCOP Domain Coordinates for d2pl6d1:

Click to download the PDB-style file with coordinates for d2pl6d1.
(The format of our PDB-style files is described here.)

Timeline for d2pl6d1: