![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily) core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection |
![]() | Superfamily b.138.1: Hydrophobin II, HfbII [101751] (1 family) ![]() |
![]() | Family b.138.1.1: Hydrophobin II, HfbII [101752] (1 protein) a self-assembling amphiphile |
![]() | Protein Hydrophobin II, HfbII [101753] (1 species) |
![]() | Species Trichoderma reesei [TaxId:51453] [101754] (4 PDB entries) |
![]() | Domain d2pl6d1: 2pl6 D:1-70 [149615] automatically matched to d1r2ma_ complexed with htg |
PDB Entry: 2pl6 (more details), 2.2 Å
SCOP Domain Sequences for d2pl6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pl6d1 b.138.1.1 (D:1-70) Hydrophobin II, HfbII {Trichoderma reesei [TaxId: 51453]} avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq allcqkaigt
Timeline for d2pl6d1: